- Recombinant Escherichia coli Uncharacterized protein yneM (yneM)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1034032
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 3,509 Da
- E Coli or Yeast
- ECK4409
- Uncharacterized protein yneM (yneM)
Sequence
MLGNMNVFMAVLGIILFSGFLAAYFSHKWDD